Museum of Zoology, University of Michigan, 1109 Geddes Avenue, Ann Arbor, Michigan 48109, USA; and
2Department of Biological Sciences, University of Denver, Denver, Colorado 80208, USA
The development of the polymerase chain reaction
(PCR) and dramatic improvements in technologies
for DNA sequencing over the last decade have pro-
vided new opportunities in avian systematics (Min-
dell 1997) and the study of population genetic struc-
3 Present address: Department of Biology, Boston
University, 5 Cummington Street, Boston, Massachu-
setts 02215, USA. E-mail: msoren@bu.edu
ture (e.g. Quinn 1992). For reasons associated with
its rapid rate of evolution, haploidy, and maternal in-
heritance (e.g. Moore 1995, Zhang and Hewitt 1996),
recent work has focused on mitochondrial DNA
(mtDNA). Direct sequencing of PCR products am-
plified from extracts of genomic DNA has circum-
vented the need for purified mtDNA. Almost any
material is now a workable source of DNA for PCR,
including blood, feathers, eggshells, feces, and other
tissues from live birds; skin, feathers, cartilage, and
bone from museum specimens; and even subfossil
bones (e.g. Cooper et al. 1992, Cooper 1994).
PCR amplification of mtDNA from total genomic
DNA, however, is associated with a significant prob-
lem: the potential for nuclear sequences to be ampli-
fied instead of or in addition to the targeted mtDNA
sequence. The transposition of mtDNA sequences to
the nucleus has been documented in a wide variety
of taxa from fungi to insects to vertebrates, and
mounting evidence suggests that it is a common if
not ubiquitous phenomenon (see Zhang and Hewitt
1996). Lopez et al. (1994) suggested the term
"Numt" to refer to nuclear sequences of mitochon-
drial origin, and we will use the term here.
Dating to transposition events from thousands to
tens of millions of years ago (e.g. Collura and Stewart
1995, Sorenson and Fleischer 1996), Numts and mi-
tochondrial sequences diverge following transposi-
tion, evolving at different rates and under different
constraints (Arctander 1995, Zischler et al. 1995). If
mistaken for mtDNA, Numts may introduce signifi-
cant error in phylogenetic analyses (see below). If co-
amplified with mtDNA, Numts greatly complicate
the accurate determination of mitochondrial se-
quences. Nonetheless, Numts present interesting op-
portunities both in the study of molecular evolution
and in phylogenetic analysis (see Zhang and Hewitt
1996, Quinn 1997). Several recent studies using ge-
nomic DNA extracted from avian blood samples
have encountered nuclear homologues of mitochon-
drial genes (Quinn 1992, Arctander 1995, Sorenson
and Fleischer 1996). Because red blood cells in birds
(and reptiles) are nucleated and relatively depauper-
ate in mtDNA, nuclear "contamination" is particu-
larly problematic with blood samples. We briefly re-
view published examples of this phenomenon in
birds, provide a new example showing that the prob-
lem is not limited to blood samples, and provide sug-
gestions for avoiding, recognizing, and working
with Numts.
Quinn and White (1987) provided the first exam-
ple of a Numt in birds, demonstrating through DNA
hybridization experiments that sequences homolo-
gous to mitochondrial genes occur in the nuclear ge-
nome of Snow Geese (Anser caerulescens). In addition,
Quinn (1992) found that blood and tissue samples
from Snow Geese yielded control-region sequences
falling into two divergent groups. Because blood had
been collected from one population and liver tissue
from another, the mistaken conclusion that these
populations were differentiated in their mtDNAs
might have been made. Careful evaluation, however,
revealed faint shadow bands (representing the
mtDNA copy) in sequences from blood and led to the
design of specific primers that allowed independent
amplification of either the mitochondrial or Numt se-
quence.
Arctander (1995) and Sorenson and Fleischer
(1996) also amplified nuclear sequences from arian
blood samples, but in these cases mitochondrial and
nuclear copies were approximately equally repre-
sented in the PCR product, resulting in sequences
with ambiguities wherever the two copies differed.
Interestingly, the pattern of phylogenetic relation-
ships among Numts and mtDNAs differed greatly in
these two studies. Arctander found that Numt cy-
tochrome-b sequences from several tapaculos (Scy-
talopus spp. and Myornis senilis) were more closely re-
lated to each other than to any of the mtDNA se-
quences of these species, suggesting a single ancient
transposition event in their common ancestor. In
contrast, Sorenson and Fleischer found that each of
six different Numts derived from the mtDNA control
region in diving ducks (Aythyini) was a close rela-
tive of the ratDNA sequence of the species in which
it was found, suggesting six recent, independent
transposition events. The implication of these con-
trasting results is that the magnitude of the error in-
troduced by an unrecognized Numt in a phyloge-
netic analysis is unpredictable.
Recently, we found an apparent Numt homolo-
gous to the mitochondrial cytochrome oxidase sub-
unit I gene (COI) in the Wandering Whistling-Duck
(Dendrocygna arcuata). In the process of sequencing
the mitochondrial genome of this species (Mindell et
al. unpubl. data), we used primers L6615 (5'-
CCTCTGTAAAAAGGACTACAGCC-3' [Miranda et
al. 1997]; L and H numbers designate the location of
the 3' base in the light or heavy strand, respectively,
of the published chicken mtDNA sequence [Desjar-
dins and Morais 1990]) and H7032 (5'-TTGCCAGCT-
AGTGGGGGGTA-3' [Miranda et al. 1997]) to ampli-
fy a 416-bp fragment including parts of COl (387 bp)
and the flanking transfer RNA (29 bp). We obtained
a single unambiguous sequence from the PCR prod-
uct but it did not perfectly match overlapping se-
quences amplified from the same sample with other
primer pairs. In addition, the inferred sequence of
amino acids included substitutions at seven sites oth-
erwise conserved in vertebrates (Table 1). Amplifi-
cation of a larger fragment with primers L6615 and
H7539 (5'-GATGTAAAGTAGGCTCGGGTGTCTAC-
3' [Miranda et al. 1997]) yielded a different unam-
biguous sequence that matched overlapping se-
quences for D. arcuata and that did not include the
unusual amino-acid substitutions.
To explore this problem further, we sequenced six
other whistling-ducks and the White-backed Duck
(Thalassornis leuconotus; sequences deposited in Gen-
bank, accession numbers U97731 to U97739), using
primers L6615 and H7032 or H7338 (5'-CCGAA-
GAATCAGAAKARRTGTTG-3', degenerate sites as
follows: K = G or T, R = A or G). None of these se-
quences had unusual amino-acid substitutions. The
sequence we initially obtained for D. arcuata is not
the result of contamination from, for example, a bac-
terial or invertebrate source. Phylogenetically, it is a
whistling-duck COl sequence, closer to several pri-
TABLE 1. Inferred amino-acid sequence for the putative D. arcuata Numt compared with that of seven Den-
drocygna (all seven species identical; see Fig. 1 for species names) and Thalassornis leuconotus mtDNAs and
comparison of H7032 primer sequence with D. arcuata mtDNA. Amino-acid substitutions at sites conserved
across vertebrates a are marked with an asterisk.
Taxon
Dendrocygna spp.
D. arcuata Numt
Thalassornis
Dendrocygna spp.
D. arcuata Numt
Thalassornis
Dendrocygna spp.
D. arcuata Numt
Thalassornis
H7032 Primer
D. arcuata mtDNA
(H-strand)
COI amino-acid sequence
VTFINRWLFSTNHKDIGTLYLIFGAWAGMIGTALSLLIRAELGQPGTLLG
DDQIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNN
........................ L ................... LLW...
MSFWLLPPSFLLLLASSTVEAGAGTGWTV
Primer sequence
TTGCCAGCTAGTGGGGGGTA
..T..T .... AA..T..A..
Including two fish (Cyprinus carpio, GenBank accession number X61010; Crossostoma lacustre, M91245), an amphibian (Xenopus laevis,
M10217), four mammals (Homo sapiens, J01415; Mus musculus, 101420; Ornitorhynchus anatinus, X83427; Didelphis virginiana, Z29573), a turtle
(Chrysemys picta), Alligator mississippiensis, and several birds (Mindell et al. unpubl. data).
marily Australasian taxa than to D. autumnalis, D. ar-
borea, or Thalassornis (Table 2, Fig. 1). That the se-
quence codes for nine amino-acid substitutions rel-
ative to other Dendrocygna, strongly suggests that it
is no longer evolving under the same selective con-
straints and supports the conclusion that it is a
Numt. Although we have not determined the flank-
ing sequence of this presumed Numt, the H7032
primer matches D. arcuata mtDNA very poorly (Table
1), suggesting that this primer preferentially ampli-
fied a nuclear sequence that it matched somewhat
better. It is possible that this apparent Numt actually
represents an intra-mitochondrial duplication of a
part of the COI gene, but this has not been detected
TABLE 2. Corrected percent genetic distance (Ki-
mura 1980) between D. arcuata Numt and mtDNA
COI sequences and other Dendrocygnini mtDNA
COI sequences.
D. arcuata D. arcuata
mtDNA Numt
D. arcuata mtDNA -- 11.6
D. javanica 5.8 13.1
D. guttata 6.9 12.8
D. bicolor 5.8 12.5
D. eytoni 8.0 13.1
D. autumnalis 11.6 14.7
D. arborea 12.3 14.7
Thalassornis
leuconotus 16.1 17.0
in sequencing over half of the mitochondrial genome
of this species.
We find this example significant because we ini-
tially obtained a single unambiguous sequence with
DNA extracted from muscle tissue, presumably with
a ratio of mitochondrial to nuclear genome copies of
1,000s to 1 (Robin and Wong 1988). Had our intent
been to infer the phylogeny of Dendrocygna based on
this single 416-bp fragment, the unusual amino-acid
sequence would have been the only indication of a
problem. Although quite divergent from D. arcuata
mtDNA, this apparent Numt has sustained no mu-
tations introducing stop codohs or reading frame
shifts. In phylogenetic analysis, substituting the D.
arcuata Numt for its mtDNA sequence leads to a very
different conclusion about the relationships of this
species (Fig. 1).
Based on our experiences with Numts in birds and
published observations, we make the following com-
ments and practical suggestions for dealing with this
phenomenon. Similar but less detailed recommen-
dations were made by Zhang and Hewitt (1996) and
Quinn (1997).
Avoiding Numts.--Because of their relatively high
ratio of nuclear to mitochondrial genome copies, avi-
an blood samples are particularly likely to yield
Numts and should be avoided for mtDNA sequenc-
ing. Although more expensive and time consuming,
preparations of purified mtDNA are the least likely
to yield Numts, followed by extractions of total DNA
from mtDNA-rich tissues. Neither, however, guar-
antees that Numts will not be amplified (e.g. Collura
and Stewart 1995). Numts may have high copy num-
ber in the nucleus (e.g. Lopez et al. 1994), and PCR
primers may favor a Numt over the mtDNA sequence
(see Smith et al. 1992, Zhang and Hewitt 1996). In
our experience, tissues that might seem relatively
poor sources of DNA, such as hardened feather
quills, work well for amplification of mtDNA and are
less problematic than blood samples with respect to
nuclear contamination.
Primer design is a critical issue in comparative se-
quencing studies. Because Numts may evolve more
slowly than mtDNA following transposition (Arc-
tander 1995, Collura and Stewart 1995, Zischler et al.
1995, Sorenson and Fleischer 1996), they diverge less
from the ancestral sequence and may be more similar
to the sequences of related taxa. As a result, primers
based on sequences from species other than the
study taxa and so-called "universal" primers may be
particularly prone to amplification of Numts. In ad-
dition, primers designed to accommodate a number
of taxa by using a consensus rule to determine the
nucleotide at each position will tend to approximate
ancestral sequences and as such may favor Numts.
One solution is to use primers targeted to highly
conserved sequences that vary little (or not at all)
among all birds, such as conserved blocks in the 12S
and 16S rRNA genes and the anticodon stem and
loop of some tRNA genes. For protein-coding genes,
however, few 20- to 25-base stretches of highly con-
served sequence exist, because most 3rd positions
are free to vary. In contrast to Zhang and Hewitt
(1996), we suggest that primers incorporating degen-
erate sites will more consistently amplify mtDNA
from tissue samples. Primers with degenerate sites
that accommodate alternative nucleotides at 3rd po-
sitions will be less likely to preferentially amplify
one sequence over another, allowing the usually high
ratio of mitochondrial to nuclear copies rather than
asymmetry in primer matching to determine the
PCR product. This assumes that variable sites in taxa
already sequenced will predict the likely variation in
additional species, an assumption that is probably
reasonable for 3rd positions in a region coding a con-
served sequence of amino acids, for example. See
Kwok et al. (1994) for suggestions on the design of
degenerate primers.
Ideally, the groundwork for a sequencing project
should include a careful evaluation of primer se-
quences in relation to published sequences for a tax-
onomic range somewhat broader than that repre-
sented in the study and sequencing of flanking
regions for a sample of the study taxa so that specific
primers with appropriate degenerate sites can be de-
signed for the study. If possible, this initial work
should be done with purified mtDNA (see Dowling
et al. 1996).
Another potential means of avoiding Numts is to
amplify the entire mtDNA or large portions of it us-
ing protocols for extended or long-PCR (e.g. Cheng
et al. 1994). Although large mtDNA fragments may
be transposed to the nucleus (e.g. Lopez et al. 1994),
most published examples involve sequences less
than 4 kB in length (Zhang and Hewitt 1996), such
that primers separated by 5 to 16 kB may amplify
only mtDNA. Even if the entire mitochondrial ge-
nome is transferred to the nucleus, a pair of primers
facing away from each other that amplify the circular
mtDNA will not amplify a linear Numt, unless the
Numt begins and ends precisely in the region not
amplified by the primers, or unless the Numt is re-
peated tandemly in the nucleus (e.g. Lopez et al.
1994). Once obtained, long products can serve as
templates for re-amplifications using internal prim-
ers for the gene of interest. This technique has been
used to eliminate apparent Numts where amplifica-
tion of smaller fragments yielded sequences with nu-
merous ambiguities (Sorenson unpubl. data). This
approach does not always work, and we speculate
that heteroduplex formation between Numts and in-
complete mtDNA extension products (as in "jump-
ing PCR"; Pbo et al. 1990) results in the incorpo-
ration of some Numt sequence in the final PCR prod-
uct.
Recognizing Numts.--In our experience, Numts of-
ten coamplify with the mtDNA copy, producing am-
biguous sequences in affected species. A careful ex-
amination of sequencing gels and electropherograms
for positions with two bands or two peaks should be
routine. Particularly when found at corresponding
positions of complimentary strands, the temptation
to simply "call" the stronger base and disregard the
weaker as an artifact should be resisted. A compar-
ison of sequences from tissue sources that vary in the
ratio of mitochondrial to nuclear genome copies (e.g.
avian blood versus muscle tissue) may provide a
strong inference that a Numt is responsible for such
ambiguities (e.g. Quinn 1992, Sorenson and Fleischer
1996).
Other lines of evidence, such as unusual amino-
acid substitutions, stop codons, and length muta-
tions in protein-coding regions may lead to the con-
clusion that a "clean" sequence is a Numt. Sequences
of rRNA and tRNA genes should be reconciled with
appropriate secondary structure models and
checked for changes incompatible with that struc-
ture. Mismatches in overlapping sequences from a
given individual should also raise suspicions. In-
deed, sequencing broadly overlapping PCR products
is a good precaution against Numts because a low
copy number Numt is unlikely to be preferentially
amplified by two different primer pairs. Finally, sig-
nificant disagreement for a particular taxon in ge-
netic distances or phylogenetic relationships derived
from different gene fragments may indicate that one
is a Numt. Numts also may yield significantly short-
er branches in phylogenetic analyses as a result of
their slower rate of evolution (Sorenson and Fleischer
A
Short Communications
/ol D. javanica
!/F D. guttata
r_-' l D. bicolor
I O. eytoni
I ' D. arcuata (Numt)
14/11 ] D. autumnalis
85 I D. arborea
Thalassornis leuconotus
[Auk, Vol. 115
B
3/10
85
1/6
1/51 D. arcuata (mtDNA)
1/21 D. javanica
I D. guttata
D. bicolor
D. eytoni
D. autumnalis
D. arborea
Thalassornis leuconotus
c
3/7
80
1/. D. arcuata (mtDNA)
D. javanica
1/5 9 D. guttata
. bicolor
D. eytoni
D. arcuata (Numt)
D. autumnalis
D. arborea
Thalassornis leuconotus
FIG. 1. Alternative phylogenetic hypotheses for Dendrocygna using (A) the putative D. arcuata Numt, (B)
the D. arcuata mtDNA sequence, and (C) both. A single most parsimonious tree was found in each analysis
using equal weights for all characters in PAUP 3.1 (Swofford 1993). Branches are drawn proportional to the
1996). Note, however, that in the absence of selective
constraints, Numts eventually will accumulate sub-
stitutions at sites conserved in mtDNAs (Arctander
1995; Fig. 1), resulting in a greater perceived rate of
change for older Numts. Such changes in addition to
length mutations and recombination eventually will
make older Numts unavailable to PCR primers.
Of course, phenomena such as mitochondrial het-
eroplasmy (Mundy et al. 1996), duplication events
within the mitochondrial genome (Moritz and
Brown 1986), and cross-contamination of samples or
reagents may account for PCR products including
more than one sequence. Numts, however, have been
the most common of these phenomena.
Working with Numts.--When Numts and mtDNA
are co-amplified, a number of techniques may be
used to separate the two copies. First, the PCR prod-
uct can be cloned and several clones sequenced to de-
termine the different sequences included in the PCR
product (e.g. Arctander 1995). Second, primers in-
ternal to the original PCR primers can be designed
to discriminate between the two sequences (e.g.
Quinn 1992, Sorenson and Fleischer 1996). Consid-
erations of primer design are exactly opposite to
those discussed above in that a primer that maxi-
mally discriminates between the two sequences is
needed. Ideally, the 3' base of the new primer(s)
should be located where Numt and mtDNA differ by
a transversion (see Kwok et al. 1990) and near ad-
ditional differences. This approach will be more cost
effective than cloning for studies of intraspecific
variation. Third, the two copies can be separated by
digesting either the genomic DNA prior to PCR or
PCR product with a restriction enzyme that cuts only
one of the copies between the PCR primers. Choice
of an enzyme is based on ambiguous positions in ini-
tial sequencing. The digested PCR product is run out
on an agarose gel to separate the fragments, which
can then be excised, purified, and sequenced (e.g. So-
renson and Fleischer 1996). Although very effective,
this technique is limited by the locations of differ-
ences between the two copies. Once two clean se-
quences are obtained, identifying them, respectively,
as Numt and mtDNA may be based on a number of
potential criteria discussed above. Alternatively, the
expressed mtDNA copy can be obtained using re-
verse-transcription of mRNA followed by PCR am-
plification of the resulting cDNA (Collura et al.
1996). This approach is powerful in that it automat-
ically identifies the functional mitochondrial copy,
but it is limited to primer pairs within a single gene.
The relative instability of mRNAs also may limit the
samples to which this technique is applied.
To the extent that Numts provide a historical record
of ancestral mtDNA sequences, they also provide op-
portunities for phylogenetic analyses. Numts may be
ideal outgroups for extant mtDNA haplotypes (Quinn
1992, Zischler et al. 1995), their presence or absence
among species can provide evidence of relationships
(e.g. Sorenson and Fleischer 1996), and they provide a
means to compare mechanisms and rates of molecular
evolution between the mitochondrial and nuclear ge-
nomes (Sorenson and Fleischer 1996, Zhang and Hewitt
1996). For these reasons, researchers may want to dis-
cover Numt sequences intentionally.
A more direct but technically demanding way to
detect Numts is to use purified mitochondrial DNA
as a probe against DNA isolated on a Southern blot.
Total DNA extracted from blood or other tissues is
restriction-endonuclease digested, size fractionated
in an agarose gel, and transferred to a nitrocellulose
or nylon membrane. In the absence of Numts, hy-
bridization of a purified mitochondrial probe with
the blot should reveal bands corresponding in posi-
tion to those obtained from digesting purified mt-
DNA alone. If Numts are present, additional bands
may be detected. Even if the Numt sequence retains
all of the same restriction sites as the mtDNA, flank-
ing regions should generate bands of unique size.
Unique bands also may correspond to restriction
fragments spanning the junction between tandemly
repeated Numt copies (e.g. Lopez et al. 1994).
By including total DNA extracts from tissue types
with different mitochondrial to nuclear DNA ratios,
the nuclear origin of anomalous bands can be veri-
fied by tissue-specific variation in the relative inten-
sity of the putative nuclear and mitochondrial bands.
Lopez et al. (1994) and Quinn and White (1987) used
information from Southern blots to complement
anomalous PCR-based sequencing results. In each
case, the Numt was present in multiple copies ar-
ranged in a tandem array. Note that such tandem re-
peats result in multiple nuclear targets for PCR
primers, potentially offsetting the high ratio of mi-
tochondrial to nuclear genome copies in most tis-
sues. This approach provides a broader survey of the
mitochondrial genome than the small regions usu-
ally studied with PCR techniques. One potential dif-
number of steps using ACCTRAN character optimization. Support indices (the number of additional steps
required in a tree without the node in question; Bremer 1988) and minimum branch length are displayed
above each node. Bootstrap percentages are shown below nodes present in more than 50% of 1,000 replicates.
For A: tree length = 190, CI = 0.69, RI = 0.49. For B: tree length = 172, CI = 0.70, RI = 0.50. For C: tree length
= 201, CI = 0.68, RI = 0.47. A sister relationship between D. arcuata and D. javanica is consistent with analyses
based on complete 12S rDNA sequences (Sorenson and Johnson unpubl. data).
ficulty is the high ratio of mitochondrial to nuclear
genome copies in most tissue extracts, which might
lead to large differences in the signal intensity be-
tween Numt versus mitochondrial targets. Avian
blood is the least biased tissue in this respect and
hence has the best chance of yielding Numts.
Acknowledgments.--The initial sequences for D. ar-
cuata were obtained as part of a mitochondrial ge-
nome project directed by David Mindell. Subsequent
laboratory analyses were supported by NSF Grant
IBN-9412399 to Robert B. Payne. T. W. Quinn was
supported by NSF Grant DEB-9629462 during prep-
aration of this manuscript. We thank Mike Lubbock,
Les Christidis, and Woody Martin for supplying
whistling-duck samples; Derek Dimcheff for assis-
tance with lab work; Carey Krajewski, David Min-
dell, Robert Payne, and two anonymous reviewers
for comments; and Alan Cooper for extensive dis-
cussion of Numts.
LITERATURE CITED
ARCTANDER, P. 1995. Comparison of a mitochondri-
al gene and a corresponding nuclear pseudo-
gene. Proceedings of the Royal Society of Lon-
don Series B 262:13-19.
BREMER, K. 1988. The limits of amino acid sequence
data in angiosperm phylogenetic reconstruction.
Evolution 42:795-803.
CHENG, S., R. HIGUCHI, AND M. STONEKING. 1994.
Complete mitochondrial genome amplification.
Nature Genetics 7:350-351.
COLLURA, R. V., M. R. AUERBACH, AND C.-B. STEW-
ART. 1996. A quick, direct method that can dif-
ferentiate expressed mitochondrial genes from
their nuclear pseudogenes. Current Biology 6:
1337-1339.
COLLURA, R. V., AND C.-g. STEWART. 1995. Insertions
and duplications of mtDNA in the nuclear ge-
nomes of Old World monkeys and hominids. Na-
ture 378:485-489.
COOPER, A. 1994. DNA from museum specimens.
Pages 149-165 in Ancient DNA: Recovery and
analysis of genetic material from paleontologi-
cal, archaeological, museum, medical, and fo-
rensic specimens (B. Herrmann and S. Herrm-
ann, Eds.). Springer-Verlag, New York.
COOPER, A., G. K. CHAMBERS, C. MOURER-CHAUVIRE,
g. VON HAESELAER, g. C. WILSON, AND S.
P..Bo. 1992. Independent origins of New Zea-
land moas and kiwis. Proceedings of the Nation-
al Academy of Sciences USA 89:8741-8744.
DESJARDINS, P., AND g. MORAIS. 1990. Sequence and
gene organization of the chicken mitochondrial
genome. A novel gene order in higher verte-
brates. Journal of Molecular Biology 212:599-
634.
DOWLING, t. E., C. MORITZ, J. D. PALMER, AND L. H.
RISENBERG. 1996. Analysis of fragments and re-
striction sites. Pages 249-320 in Molecular sys-
tematics, 2nd ed. (D. M. Hillis, C. Moritz, and B.
K. Mable, Eds.). Sinauer Associates, Sunderland,
Massachusetts.
KIMURA, M. 1980. A simple method for estimating
evolutionary rate of base substitutions through
comparative studies of nucleotide sequences.
Journal of Molecular Evolution 17:111-120.
KWOK, S., S.-Y. CHANG, J. J. SNINSKY, AND g. WANG.
1994. A guide to the design and use of mis-
matched and degenerate primers. PCR Methods
and Applications 3:S39-S47.
KWOK, S., D. E. KELLOGG, N. MCKINNEY, D. SPASiC,
L. GODA, C. LIVENSON, AND J. J. SNINSKY. 1990.
Effects of primer-template mismatches on the
polymerase chain reaction: Human immunode-
ficiency virus type 1 model studies. Nucleic Ac-
ids Research 18:999-1005.
LOPEZ, J. V., N. YUHKI, R. MASUDA, W. MODI, AND S.
J. O'BRIEN. 1994. Numt, a recent transfer and
tandem amplification of mitochondrial DNA to
the nuclear genome of the domestic cat. Journal
of Molecular Evolution 39:174-190.
MINDELL, D. P. (Ed.) 1997. Avian molecular evolu-
tion and systematics. Academic Press, New York.
MIRANDA, H. C., R. S. KENNEDY, AND D. P. MINDELL.
1997. Phylogenetic placement of Mimizuku gur-
neyi (Aves: Strigidae) inferred from mitochon-
drial DNA. Auk 115:315-323.
MOORE, W. S. 1995. Inferring phylogenies from
mtDNA variation: Mitochondrial-gene trees ver-
sus nuclear~gene trees. Evolution 49:718-726.
MORITZ, C., AND W. M. BROWN. 1986. Tandem du-
plication of D-loop and ribosomal RNA sequenc-
es in lizard mitochondrial DNA. Science 233:
1425-1427.
MUNDY, N. I., C. S. WINCHELL, AND D. S. WOODRUFF.
1996. Tandem repeats and heteroplasmy in the
mitochondrial DNA control region of the Log-
gerhead Shrike (Lanius ludovicianus). Journal of
Heredity 87:21-26.
P..BO, S., D. M. IRWIN, AND A. C. WILSON. 1990.
DNA damage promotes jumping between tem-
plates during enzymatic amplification. Journal
of Biological Chemistry 265:4718-4721.
QUINN, t. W. 1992. The genetic legacy of Mother
Goose--phylogeographic patterns of Lesser
Snow Goose Chen caerulescens maternal lineages.
Molecular Ecology 1:105-117.
QUINN, T. W. 1997. Molecular evolution of the mi-
tochondrial genome. Pages 3-28 in Avian molec-
ular evolution and systematics (D. P. Mindell,
Ed.). Academic Press, New York.
QUINN, t. W., AND B. N. WHITE. 1987. Analysis of
DNA sequence variation. Pages 163-198 in Avian
genetics: A population and ecological approach
(E Cooke and P. A. Buckley, Eds.). Academic
Press, London.
ROBIN, E.D., AND R. WONG. 1988. Mitochondrial
DNA molecules and virtual number of mito-
chondria per cell in mammalian cells. Joumal of
Cellular Physiology 136:507-513.
SMITH, M. E, W. K. THOMAS, AND J. L. PATTON. 1992.
Mitohcondrial DNA-like sequences in the nucle-
ar genome of an akodontine rodent. Molecular
Biology and Evolution 9:204-215.
SORENSON, g. D., AND R. C. FLEISCHER. 1996. Mul-
tiple independent transpositions of mitochon-
drial DNA control region sequences to the nu-
cleus. Proceedings of the National Academy of
Sciences USA 93:15239-15243.
SWOFFORD, D. L. 1993. PAUP: Phylogenetic analysis
using parsiomony, version 3.1. Illinois Natural
History Survey, Champaign.
ZHANG, D.-X., AND G. M. HEWITT. 1996. Nuclear in-
tegrations: Challenges for mitochondrial DNA
markers. Trends in Ecology and Evolution 11:
247-251.
ZISCHLER, H., H. GEISERT, g. VON HAESELER, AND S.
PAABO. 1995. A nuclear "fossil" of the mito-
chondrial D-loop and the origin of modern hu-
mans. Nature 378:489-492.
Received 9 December 1996, accepted 4 June 1997.
Associate Editor: R. M. Zink